PBXIP1 Rabbit Antibody TA331826 from OriGene Technologies | Biocompare.com

Supplier Images

PBXIP1 Rabbit Antibody

WB Suggested Anti-PBXIP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
PBXIP1 Rabbit Antibody

Host: Rabbit
Target Name: PBXIP1
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PBXIP1 Rabbit Antibody

Description

Rabbit Polyclonal Anti-PBXIP1 Antibody

Product Specs
ItemPBXIP1 Rabbit Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331826
Quantity100 µl
Conjugate/TagUnconjugated
ReactivityHuman
TargetPBXIP1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-PBXIP1 Antibody: synthetic peptide directed towards the N terminal of human PBXIP1. Synthetic peptide located within the following region: AGGEGAGGELGISLNMCLLGALVLLGLGVLLFSGGLSESETGPMEEVERQ
NCBI Full Gene NamePBX homeobox interacting protein 1
NCBI Gene AliasesHPIP
TypePrimary Antibodies
FormatShipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!