ABCF1 Rabbit Polyclonal Antibody TA332251 from OriGene Technologies | Biocompare.com

Supplier Images

ABCF1 Rabbit Polyclonal Antibody

WB Suggested Anti-Abcf1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Mouse Brain
ABCF1 Rabbit Polyclonal Antibody

Researcher: Dr. Joanna Stewart, Centre for Biological Sciences, University of Southampton; Application: IP; Species+tissue/cell type: 1: 500 ug HEK293 cell lysate transfected with ABCF1 wt, 2: 500 ug HEK293 cell lysate untransfected, 3: 500 ug HEK293 cell

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ABCF1 Rabbit Polyclonal Antibody

The ABCF1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to ABCF1. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The ABCF1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Precipitation, Immunoprecipitation, and Western Blot.

Description

Rabbit Polyclonal Anti-Abcf1 Antibody

Product Specs
ItemABCF1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA332251
Quantity100 µl
ApplicationsIP, WB
Conjugate/TagUnconjugated
ReactivityHuman, Mouse
TargetABCF1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Abcf1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: GGKSTKQAEKQTKEVLTRKQQKCRRKNQDEESQDPPELLKRPREYTVRFT
NCBI Full Gene NameATP binding cassette subfamily F member 1
NCBI Gene AliasesABC50, ABC27
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!