C11orf65 Rabbit Polyclonal Antibody TA338878 from OriGene Technologies | Biocompare.com

Supplier Images

C11orf65 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: C11orf65; Sample Tissue: Stomach tumor lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C11orf65 Rabbit Polyclonal Antibody

OriGene Technologies' C11orf65 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-C11orf65 Antibody

Product Specs
ItemC11orf65 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338878
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetC11orf65
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-C11orf65 antibody is: synthetic peptide directed towards the N-terminal region of Human C11orf65. Synthetic peptide located within the following region: YAKLPAKHTSHNKNDHLQEEDHSGWYHRIENNGWRPVSDTFWLSTDGMVV
NCBI Full Gene Namechromosome 11 open reading frame 65
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
NCBI Gene AliasesMFI

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!