NSUN3 Rabbit Polyclonal Antibody TA346815 from OriGene Technologies | Biocompare.com

Supplier Images

NSUN3 Rabbit Polyclonal Antibody

WB Suggested Anti-NSUN3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Pancreas

Be the first to write a review!

Supplier Page from
OriGene Technologies for
NSUN3 Rabbit Polyclonal Antibody

The NSUN3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to Nsun3. This antibody recognizes Homo Sapiens, and Human antigen. The NSUN3 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-NSUN3 Antibody

Product Specs
ItemNSUN3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346815
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetNSUN3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-NSUN3 antibody: synthetic peptide directed towards the middle region of human NSUN3. Synthetic peptide located within the following region: GGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSEL
NCBI Full Gene NameNOP2/Sun RNA methyltransferase 3
NCBI Gene AliasesMST077, COXPD48, MSTP077
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!