LMF1 Rabbit Polyclonal Antibody TA338619 from OriGene Technologies | Biocompare.com

Supplier Images

LMF1 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: LMF1; Sample Tissue: Lung Tumor lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
LMF1 Rabbit Polyclonal Antibody

The LMF1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to lipase maturation factor 1, and LMF1. This antibody recognizes Homo Sapiens, and Human antigen. The LMF1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-LMF1 Antibody

Product Specs
ItemLMF1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338619
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman
TargetLMF1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-LMF1 antibody is: synthetic peptide directed towards the N-terminal region of Human LMF1. Synthetic peptide located within the following region: LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG
NCBI Full Gene Namelipase maturation factor 1
NCBI Gene AliasesHMFN1876, TMEM112, C16orf26, TMEM112A, JFP11
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!