EMID2 (COL26A1) Rabbit Polyclonal Antibody TA340272 from OriGene Technologies | Biocompare.com

Supplier Images

EMID2 (COL26A1) Rabbit Polyclonal Antibody

WB Suggested Anti-COL26A1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
EMID2 (COL26A1) Rabbit Polyclonal Antibody

OriGene Technologies' EMID2 (COL26A1) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-COL26A1 Antibody

Product Specs
ItemEMID2 (COL26A1) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA340272
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetEMID2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-COL26A1 antibody: synthetic peptide directed towards the C terminal of human COL26A1. Synthetic peptide located within the following region: GVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKR
NCBI Full Gene Namecollagen type XXVI alpha 1 chain
NCBI Gene AliasesEMI6, EMID2, SH2B, EMU2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!