C20orf19 (KIZ) Rabbit Polyclonal Antibody TA346629 from OriGene Technologies | Biocompare.com

Supplier Images

C20orf19 (KIZ) Rabbit Polyclonal Antibody

WB Suggested Anti-C20orf19 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Human heart

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C20orf19 (KIZ) Rabbit Polyclonal Antibody

OriGene Technologies' C20orf19 (KIZ) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-C20orf19 Antibody

Product Specs
ItemC20orf19 (KIZ) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA346629
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC20orf19
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C20orf19 antibody: synthetic peptide directed towards the C terminal of human C20orf19. Synthetic peptide located within the following region: SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD
NCBI Full Gene Namekizuna centrosomal protein
NCBI Gene AliasesKizuna, C20orf19, HT013, RP69, PLK1S1, NCRNA00153
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!