DDX49 Rabbit Polyclonal Antibody TA341609 from OriGene Technologies | Biocompare.com

Supplier Images

DDX49 Rabbit Polyclonal Antibody

WB Suggested Anti-DDX49 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Thymus

Be the first to write a review!

Supplier Page from
OriGene Technologies for
DDX49 Rabbit Polyclonal Antibody

The DDX49 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to DDX49, and DEAD-box helicase 49. This antibody recognizes Homo Sapiens, and Human antigen. The DDX49 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-DDX49 Antibody

Product Specs
ItemDDX49 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA341609
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetDDX49
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-DDX49 antibody: synthetic peptide directed towards the N terminal of human DDX49. Synthetic peptide located within the following region: ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR
NCBI Full Gene NameDEAD-box helicase 49
NCBI Gene AliasesDbp8, R27090_2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!