C13orf7 (RNF219) Rabbit Polyclonal Antibody TA330467 from OriGene Technologies | Biocompare.com

Supplier Images

C13orf7 (RNF219) Rabbit Polyclonal Antibody

WB Suggested Anti-C13orf7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysateRNF219 is supported by BioGPS gene expression data to be expressed in 721_B

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C13orf7 (RNF219) Rabbit Polyclonal Antibody

The C13orf7 (RNF219) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to OBI1, and ORC ubiquitin ligase 1. This antibody recognizes Homo Sapiens, and Human antigen. The C13orf7 (RNF219) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RNF219 Antibody

Product Specs
ItemC13orf7 (RNF219) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330467
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetC13orf7
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C13orf7 antibody: synthetic peptide directed towards the N terminal of human C13orf7. Synthetic peptide located within the following region: LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG
NCBI Full Gene NameORC ubiquitin ligase 1
NCBI Gene AliasesC13orf7, RNF219
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!