RAD54B Rabbit Polyclonal Antibody TA341584 from OriGene Technologies | Biocompare.com

Supplier Images

RAD54B Rabbit Polyclonal Antibody

WB Suggested Anti-RAD54B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain
RAD54B Rabbit Polyclonal Antibody

Rabbit Anti-RAD54B Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Nuclear in hepatocytes, very strong signal, wide tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: Donkey anti-Rabbi

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RAD54B Rabbit Polyclonal Antibody

OriGene Technologies' RAD54B Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-RAD54B Antibody

Product Specs
ItemRAD54B Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA341584
Quantity100 µl
ApplicationsIHC, WB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRAD54B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV
NCBI Full Gene NameRAD54 homolog B
NCBI Gene AliasesRDH54
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!