FAM38B (PIEZO2) Rabbit Polyclonal Antibody TA338481 from OriGene Technologies

Product Specs
ItemFAM38B (PIEZO2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338481
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetFAM38B
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-PIEZO2antibody: synthetic peptide directed towards the middle region of human FAM38B. Synthetic peptide located within the following region: AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS
NCBI Full Gene Namepiezo type mechanosensitive ion channel component 2
NCBI Gene AliasesFAM38B2, MWKS, C18orf58, C18orf30, DA5, DA3, HsT748, FAM38B, HsT771, DAIPT
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

How In-Cell Westerns Can Advance Your Research
January 24, 2024
Capabilities include capturing even the most subtle variations in protein expression read more
How to Enhance Membrane Protein Research
April 24, 2023
Long considered difficult to characterize, new methods are having an impact. read more
How to Produce Publication-Worthy Western Blots
February 07, 2023
Stricter guidelines require adherence to best practices. read more
How to Obtain Publication-Quality IP-Western Blot Data
March 01, 2022
Learn from experts how to improve IP-WB data. read more
Selecting the Right Western Blotting Detection Method
May 27, 2020
Recent advances support better identification and quantification of proteins read more
Ways to Win at Western Blotting
March 23, 2020
Recent advances help minimize the need for troubleshooting read more
The Magic’s In the Membrane: Choose Wisely for Best Western Blot Results
April 08, 2013
It is important to validate the correct membrane type for your experimental conditions. Choosing the correct membrane type for Western blotting can help prevent transfer inefficiencies, reduce background after staining ... read more

FAM38B (PIEZO2) Rabbit Polyclonal Antibody