ZNF313 (RNF114) Rabbit Polyclonal Antibody TA331847 from OriGene Technologies | Biocompare.com

Supplier Images

ZNF313 (RNF114) Rabbit Polyclonal Antibody

WB Suggested Anti-ZNF313 Antibody Titration: 1.25ug/ml; ELISA Titer: 1: 312500; Positive Control: Transfected 293T

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ZNF313 (RNF114) Rabbit Polyclonal Antibody

OriGene Technologies' ZNF313 (RNF114) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The ZNF313 (RNF114) Rabbit Polyclonal Antibody was generated using RNF114 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-ZNF313 Antibody

Product Specs
ItemZNF313 (RNF114) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA331847
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetZNF313
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-ZNF313 Antibody: synthetic peptide directed towards the N terminal of human ZNF313. Synthetic peptide located within the following region: AVELERQIESTETSCHGCRKNFFLSKIRSHVATCSKYQNYIMEGVKATIK
NCBI Full Gene Namering finger protein 114
NCBI Gene AliasesZNF313, PSORS12
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!