Rab6b Rabbit Polyclonal Antibody TA331219 from OriGene Technologies | Biocompare.com

Supplier Images

Rab6b Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Rab6b; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rab6b Rabbit Polyclonal Antibody

The Rab6b Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RAB6B. This antibody recognizes Mouse antigen. The Rab6b Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Rab6b Antibody

Product Specs
ItemRab6b Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331219
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRab6b
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rab6b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rab6b. Synthetic peptide located within the following region: KTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASEGGCS
NCBI Full Gene NameRAB6B, member RAS oncogene family
NCBI Gene AliasesC330006L04Rik, 9630015C03, D9Bwg0185e
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!