RIMS3 Rabbit Polyclonal Antibody TA338081 from OriGene Technologies | Biocompare.com

Supplier Images

RIMS3 Rabbit Polyclonal Antibody

WB Suggested Anti-RIMS3 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate RIMS3 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
RIMS3 Rabbit Polyclonal Antibody

Human kidney

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RIMS3 Rabbit Polyclonal Antibody

OriGene Technologies' RIMS3 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-RIMS3 Antibody

Product Specs
ItemRIMS3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA338081
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityMouse, Human
TargetRIMS3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RIMS3 antibody: synthetic peptide directed towards the C terminal of human RIMS3. Synthetic peptide located within the following region: IMLDELDLSAAVTGWYKLFPTSSVADSTLGSLTRRLSQSSLESATSPSCS
NCBI Full Gene Nameregulating synaptic membrane exocytosis 3
NCBI Gene AliasesNIM3, RIM 3, RIM3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!