RAP1A Rabbit Polyclonal Antibody TA343312 from OriGene Technologies | Biocompare.com

Supplier Images

RAP1A Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Rap1a; Sample Tissue: Mouse Testis lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RAP1A Rabbit Polyclonal Antibody

The RAP1A Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody. This antibody recognizes Mouse antigen. The RAP1A Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RAP1A Antibody

Product Specs
ItemRAP1A Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA343312
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetRAP1A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Rap1a antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rap1a. Synthetic peptide located within the following region: GQNLARQWCNCAFLESSAKSKINVNEIFYDLVRQINRKTPVEKKKPKKKS
NCBI Full Gene NameRAP1A, member of RAS oncogene family
NCBI Gene AliasesC21KG, SMGP21, RAP1, KREV1, KREV-1, G-22K
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!