POU2F3 Rabbit Polyclonal Antibody TA330590 from OriGene Technologies | Biocompare.com

Supplier Images

POU2F3 Rabbit Polyclonal Antibody

WB Suggested Anti-POU2F3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate
POU2F3 Rabbit Polyclonal Antibody

Human Muscle
POU2F3 Rabbit Polyclonal Antibody

Sample Type : Mouse tongue tissuePrimary Antibody Dilution : 1:100Secondary Antibody : Anti-rabbit-Cy3Secondary Antibody Dilution : 1:500Color/Signal Descriptions : Red: POU2F3Gene Name : POU2F3Submitted by : Dr. Hong Wang, Monell Chemical Senses Center

Be the first to write a review!

Supplier Page from
OriGene Technologies for
POU2F3 Rabbit Polyclonal Antibody

OriGene Technologies' POU2F3 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-POU2F3 Antibody

Product Specs
ItemPOU2F3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330590
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
ReactivityHuman, Rat, Mouse
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
TargetPOU2F3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
TypePrimary Antibodies
ImmunogenThe immunogen for anti-POU2F3 antibody: synthetic peptide directed towards the N terminal of human POU2F3. Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR
NCBI Full Gene NamePOU class 2 homeobox 3
NCBI Gene AliasesEpoc-1, PLA-1, PLA1, OCT-11, OCT11, OTF-11, Skn-1a
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!