RPS18 Rabbit Polyclonal Antibody TA330910 from OriGene Technologies | Biocompare.com

Supplier Images

RPS18 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RPS18; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RPS18 Rabbit Polyclonal Antibody

OriGene Technologies' RPS18 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RPS18 Rabbit Polyclonal Antibody was generated using RPS18 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RPS18 Antibody

Product Specs
ItemRPS18 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330910
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetRPS18
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK
NCBI Full Gene Nameribosomal protein S18
NCBI Gene AliasesS18, D6S218E, uS13, HKE3, KE-3, KE3
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!