RRP15 Rabbit Polyclonal Antibody TA331932 from OriGene Technologies | Biocompare.com

Supplier Images

RRP15 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RRP15; Sample Tissue: A549 Whole Cell lysates; Antibody Dilution: 1.0ug/ml. RRP15 is supported by BioGPS gene expression data to be expressed in A549

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RRP15 Rabbit Polyclonal Antibody

The RRP15 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RRP15. This antibody recognizes Homo Sapiens, and Human antigen. The RRP15 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RRP15 Antibody

Product Specs
ItemRRP15 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331932
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetRRP15
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RRP15 Antibody is: synthetic peptide directed towards the C-terminal region of Human RRP15. Synthetic peptide located within the following region: ISTVSKKDFISVLRGMDGSTNETASSRKKPKAKQTEVKSEEGPGWTILRD
NCBI Full Gene Nameribosomal RNA processing 15 homolog
NCBI Gene AliasesCGI-115, KIAA0507
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!