Rgs10 Rabbit Polyclonal Antibody TA329547 from OriGene Technologies | Biocompare.com

Supplier Images

Rgs10 Rabbit Polyclonal Antibody

WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Mouse Thymus
Rgs10 Rabbit Polyclonal Antibody

FACS -- Sample type: Bone marrow derived monocytes from mice BV2 cellsDilution: 1ug/mL

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rgs10 Rabbit Polyclonal Antibody

OriGene Technologies' Rgs10 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Flow Cytometry, and Western Blot.

Description

Rabbit Polyclonal anti-Rgs10 antibody

Product Specs
ItemRgs10 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329547
Quantity100 µl
ApplicationsFC, WB
Conjugate/TagUnconjugated
ReactivityMouse
TargetRgs10
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Rgs10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE
NCBI Full Gene Nameregulator of G-protein signalling 10
NCBI Gene Aliases2310010N19Rik
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!