PDAP1 Rabbit Polyclonal Antibody TA344202 from OriGene Technologies | Biocompare.com

Supplier Images

PDAP1 Rabbit Polyclonal Antibody

WB Suggested Anti-PDAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PDAP1 Rabbit Polyclonal Antibody

The PDAP1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to PDAP1. This antibody recognizes Homo Sapiens, and Human antigen. The PDAP1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-PDAP1 Antibody - N-terminal region

Product Specs
ItemPDAP1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA344202
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
ReactivityHuman
TargetPDAP1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
TypePrimary Antibodies
ImmunogenThe immunogen for anti-PDAP1 antibody: synthetic peptide directed towards the N terminal of human PDAP1. Synthetic peptide located within the following region: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGD
NCBI Full Gene NamePDGFA associated protein 1
NCBI Gene AliasesPAP, HASPP28, PAP1
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!