C6orf206 (RSPH9) Rabbit Polyclonal Antibody TA334369 from OriGene Technologies | Biocompare.com

Supplier Images

C6orf206 (RSPH9) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RSPH9; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C6orf206 (RSPH9) Rabbit Polyclonal Antibody

OriGene Technologies' C6orf206 (RSPH9) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The C6orf206 (RSPH9) Rabbit Polyclonal Antibody was generated using RSPH9 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RSPH9 Antibody

Product Specs
ItemC6orf206 (RSPH9) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA334369
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC6orf206
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RSPH9 antibody is: synthetic peptide directed towards the middle region of Human RSPH9. Synthetic peptide located within the following region: VKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQID
NCBI Full Gene Nameradial spoke head component 9
NCBI Gene AliasesC6orf206, MRPS18AL1, CILD12
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!