RRAGB Rabbit Polyclonal Antibody TA331223 from OriGene Technologies | Biocompare.com

Supplier Images

RRAGB Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RRAGB; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RRAGB Rabbit Polyclonal Antibody

OriGene Technologies' RRAGB Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RRAGB Rabbit Polyclonal Antibody was generated using RRAGB as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RRAGB Antibody

Product Specs
ItemRRAGB Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331223
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
ReactivityHuman
TargetRRAGB
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RRAGB antibody is: synthetic peptide directed towards the C-terminal region of Human RRAGB. Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM
NCBI Full Gene NameRas related GTP binding B
NCBI Gene AliasesRAGB, bA465E19.1
ClonalityPolyclonal

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!