C12orf11 (ASUN) Rabbit Polyclonal Antibody TA344919 from OriGene Technologies | Biocompare.com

Supplier Images

C12orf11 (ASUN) Rabbit Polyclonal Antibody

WB Suggested Anti-C12orf11 Antibody Titration: 0.2-1 ug/ml; Positive Control: OVCAR-3 cell lysateASUN is supported by BioGPS gene expression data to be expressed in OVCAR3

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C12orf11 (ASUN) Rabbit Polyclonal Antibody

OriGene Technologies' C12orf11 (ASUN) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The C12orf11 (ASUN) Rabbit Polyclonal Antibody was generated using INTS13 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-C12orf11 Antibody - middle region

Product Specs
ItemC12orf11 (ASUN) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA344919
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetC12orf11
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C12orf11 antibody: synthetic peptide directed towards the middle region of human C12orf11. Synthetic peptide located within the following region: VQQHFDLASTTITNIPMKEEQHANTSANYDVELLHHKDAHVDFLKSGDSH
NCBI Full Gene Nameintegrator complex subunit 13
NCBI Gene AliasesMat89Bb, NET48, ASUN, SPATA30, C12orf11, GCT1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!