Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody TA330011 from OriGene Technologies | Biocompare.com

Supplier Images

Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

WB Suggested Anti-RPH3A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Small Intestine

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody

OriGene Technologies' Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Rabphilin 3A (RPH3A) Rabbit Polyclonal Antibody was generated using Rph3a as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RPH3A Antibody

Product Specs
ItemRabphilin 3A (RPH3A) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA330011
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetRabphilin 3A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RPH3A antibody: synthetic peptide directed towards the N terminal of human RPH3A. Synthetic peptide located within the following region: GQPDRQRKQEELTDEEKEIINRVIARAEKMEEMEQERIGRLVDRLENMRK
NCBI Full Gene Namerabphilin 3A
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!