Dapl1 Rabbit Polyclonal Antibody TA331715 from OriGene Technologies | Biocompare.com

Supplier Images

Dapl1 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Dapl1; Sample Tissue: Mouse Kidney lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Dapl1 Rabbit Polyclonal Antibody

OriGene Technologies' Dapl1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Dapl1 Rabbit Polyclonal Antibody was generated using DAPL1 as the antigen and it reacts with Mouse.

Description

Rabbit Polyclonal Anti-Dapl1 Antibody

Product Specs
ItemDapl1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331715
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetDapl1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Dapl1 Antibody is: synthetic peptide directed towards the N-terminal region of Mouse Dapl1. Synthetic peptide located within the following region: MANEVQVLPSPLKGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSA
NCBI Full Gene Namedeath associated protein-like 1
NCBI Gene AliasesEEDA, 2310032F03Rik
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!