RHBG Rabbit Polyclonal Antibody TA338417 from OriGene Technologies | Biocompare.com

Supplier Images

RHBG Rabbit Polyclonal Antibody

WB Suggested Anti-RHBG Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate. RHBG is supported by BioGPS gene expression data to be expressed in HepG2
RHBG Rabbit Polyclonal Antibody

Liver

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RHBG Rabbit Polyclonal Antibody

OriGene Technologies' RHBG Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-RHBG Antibody

Product Specs
ItemRHBG Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $575.00Supplier Page View Company Product Page
Catalog NumberTA338417
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRHBG
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RHBG antibody: synthetic peptide directed towards the C terminal of human RHBG. Synthetic peptide located within the following region: LATHEAYGDGLESVFPLIAEGQRSATSQAMHQLFGLFVTLMFASVGGGLG
NCBI Full Gene NameRh family B glycoprotein
NCBI Gene AliasesSLC42A2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!