RNF13 Rabbit Polyclonal Antibody TA334770 from OriGene Technologies | Biocompare.com

Supplier Images

RNF13 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Rnf13; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RNF13 Rabbit Polyclonal Antibody

The RNF13 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RNF13. This antibody recognizes Mouse antigen. The RNF13 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Rnf13 Antibody

Product Specs
ItemRNF13 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA334770
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityMouse
TargetRnf13
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-Rnf13 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rnf13. Synthetic peptide located within the following region: IGESSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILIV
NCBI Full Gene Namering finger protein 13
NCBI Gene AliasesEIEE73, DEE73, RZF
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!