RPL28 Rabbit Polyclonal Antibody TA338305 from OriGene Technologies | Biocompare.com

Supplier Images

RPL28 Rabbit Polyclonal Antibody

WB Suggested Anti-RPL28 Antibody; Titration: 1.0 ug/ml; Positive Control: 293T Whole Cell RPL28 is supported by BioGPS gene expression data to be expressed in HEK293T

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RPL28 Rabbit Polyclonal Antibody

OriGene Technologies' RPL28 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The RPL28 Rabbit Polyclonal Antibody was generated using RPL28 as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-RPL28 Antibody

Product Specs
ItemRPL28 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338305
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRPL28
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: SSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV
NCBI Full Gene Nameribosomal protein L28
NCBI Gene AliasesL28, eL28
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!