OLFML1 Rabbit Polyclonal Antibody TA333371 from OriGene Technologies | Biocompare.com

Supplier Images

OLFML1 Rabbit Polyclonal Antibody

WB Suggested Anti-OLFML1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
OLFML1 Rabbit Polyclonal Antibody

The OLFML1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to olfactomedin like 1, and OLFML1. This antibody recognizes Homo Sapiens, and Human antigen. The OLFML1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-OLFML1 Antibody

Product Specs
ItemOLFML1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA333371
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetOLFML1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-OLFML1 Antibody: synthetic peptide directed towards the middle region of human OLFML1. Synthetic peptide located within the following region: LCGVLYVVYSTGGQGPHRITCIYDPLGTISEEDLPNLFFPKRPRSHSMIH
NCBI Full Gene Nameolfactomedin like 1
NCBI Gene AliasesMVAL564, UNQ564
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!