PCGF3 Rabbit Polyclonal Antibody TA335695 from OriGene Technologies | Biocompare.com

Supplier Images

PCGF3 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: PCGF3; Sample Tissue: Fetal Muscle lysates; Antibody Dilution: 1.0 ug/ml
PCGF3 Rabbit Polyclonal Antibody

WB Suggested Anti-PCGF3 Antibody Titration: 0.125 ug/ml; ELISA Titer: 1:12500; Positive Control: Raji cell lysatePCGF3 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells

Be the first to write a review!

Supplier Page from
OriGene Technologies for
PCGF3 Rabbit Polyclonal Antibody

The PCGF3 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to PCGF3. This antibody recognizes Homo Sapiens, and Human antigen. The PCGF3 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-PCGF3 Antibody

Product Specs
ItemPCGF3 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA335695
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetPCGF3
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED
NCBI Full Gene Namepolycomb group ring finger 3
NCBI Gene AliasesDONG1, RNF3, RNF3A
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!