FSIP2 Rabbit Polyclonal Antibody TA331485 from OriGene Technologies | Biocompare.com

Supplier Images

FSIP2 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: FSIP2; Sample Tissue: Placenta lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
FSIP2 Rabbit Polyclonal Antibody

The FSIP2 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to FSIP2. This antibody recognizes Homo Sapiens, and Human antigen. The FSIP2 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-FSIP2 Antibody

Product Specs
ItemFSIP2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA331485
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityHuman
TargetFLJ44048
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-FSIP2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FSIP2. Synthetic peptide located within the following region: GNSVKFITIFERSKDVLGSANPSKEVISETPKPDVSKQGSKMLTKMSSTL
NCBI Full Gene Namefibrous sheath interacting protein 2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose
NCBI Gene AliasesSPGF34

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!