MITF Rabbit Polyclonal Antibody TA335168 from OriGene Technologies | Biocompare.com

Supplier Images

MITF Rabbit Polyclonal Antibody

WB Suggested Anti-MITF Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
MITF Rabbit Polyclonal Antibody

The MITF Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to melanocyte inducing transcription factor, and MITF. This antibody recognizes Homo Sapiens, Human, and Mouse antigen. The MITF Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-MITF Antibody

Product Specs
ItemMITF Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $525.00Supplier Page View Company Product Page
Catalog NumberTA335168
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityProtein A purified
ReactivityHuman, Mouse
TargetMITF
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-MITF antibody: synthetic peptide directed towards the N terminal of human MITF. Synthetic peptide located within the following region: THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMP
NCBI Full Gene Namemelanocyte inducing transcription factor
NCBI Gene AliasesbHLHe32, MI, MITF-A, COMMAD, WS2, WS2A, CMM8
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!