Rcan1 Rabbit Polyclonal Antibody TA329361 from OriGene Technologies | Biocompare.com

Supplier Images

Rcan1 Rabbit Polyclonal Antibody

WB Suggested Anti-Rcan1 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rcan1 Rabbit Polyclonal Antibody

The Rcan1 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to Rcan1. This antibody recognizes Rat antigen. The Rcan1 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal anti-Rcan1 Antibody

Product Specs
ItemRcan1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329361
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityRat
TargetRcan1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rcan1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Rcan1. Synthetic peptide located within the following region: HLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPLSAAD
NCBI Full Gene Nameregulator of calcineurin 1
NCBI Gene AliasesMcip1, Dscr1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!