RPS3A Rabbit Polyclonal Antibody TA336162 from OriGene Technologies | Biocompare.com

Supplier Images

RPS3A Rabbit Polyclonal Antibody

WB Suggested Anti-RPS3A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Liver
RPS3A Rabbit Polyclonal Antibody

Sample Type: Arabidopsis thaliana extract (30ug); Primary Diltution: 1:1000; Secondary Antibody: anti-rabbit HRP; Secondary Dilution: 1:15,000; Exposure Time: 1 minute; Image Submitted By: Anonymous

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RPS3A Rabbit Polyclonal Antibody

OriGene Technologies' RPS3A Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-RPS3A Antibody

Product Specs
ItemRPS3A Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA336162
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman, Arabidopsis thaliana
TargetRPS3A
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RPS3A Antibody: synthetic peptide directed towards the N terminal of human RPS3A. Synthetic peptide located within the following region: APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF
NCBI Full Gene Nameribosomal protein S3A
NCBI Gene AliasesFTE1, S3A, MFTL, eS1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!