RPL11 Rabbit Polyclonal Antibody TA338284 from OriGene Technologies | Biocompare.com

Supplier Images

RPL11 Rabbit Polyclonal Antibody

WB Suggested Anti-RPL11 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole Cell RPL11 is supported by BioGPS gene expression data to be expressed in HeLa

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RPL11 Rabbit Polyclonal Antibody

OriGene Technologies' RPL11 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-RPL11 Antibody

Product Specs
ItemRPL11 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA338284
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRPL11
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RPL11 antibody is: synthetic peptide directed towards the C-terminal region of Human RPL11. Synthetic peptide located within the following region: DFYVVLGRPGFSIADKKRRTGCIGAKHRISKEEAMRWFQQKYDGIILPGK
NCBI Full Gene Nameribosomal protein L11
NCBI Gene AliasesDBA7, GIG34, L11, uL5
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!