RNF151 Rabbit Polyclonal Antibody TA333452 from OriGene Technologies | Biocompare.com

Supplier Images

RNF151 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RNF151; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml.

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RNF151 Rabbit Polyclonal Antibody

OriGene Technologies' RNF151 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-RNF151 Antibody

Product Specs
ItemRNF151 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA333452
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRNF151
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RNF151 Antibody is: synthetic peptide directed towards the middle region of Human RNF151. Synthetic peptide located within the following region: AHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGC
NCBI Full Gene Namering finger protein 151
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!