Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody TA335246 from OriGene Technologies | Biocompare.com

Supplier Images

Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: TPO; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody

OriGene Technologies' Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody was generated using thyroid peroxidase, and TPO as the antigen and it reacts with Homo Sapiens, and Human.

Description

Rabbit Polyclonal Anti-TPO Antibody

Product Specs
ItemThyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA335246
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetThyroid Peroxidase
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS
NCBI Full Gene Namethyroid peroxidase
NCBI Gene AliasesTDH2A, MSA, TPX
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!