Rbfox2 Rabbit Polyclonal Antibody TA329611 from OriGene Technologies | Biocompare.com

Supplier Images

Rbfox2 Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: Rbfox2; Sample Tissue: NIH-3T3 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Rbfox2 Rabbit Polyclonal Antibody

The Rbfox2 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RBFOX2. This antibody recognizes Mouse antigen. The Rbfox2 Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit polyclonal anti-Rbfox2 Antibody

Product Specs
ItemRbfox2 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329611
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityMouse
TargetRbfox2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
NCBI Full Gene NameRNA binding protein, fox-1 homolog (C. elegans) 2
NCBI Gene AliasesFbm2, Fxh, Rbm9, Hrnbp2
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!