ENC1 Rabbit Polyclonal Antibody TA335766 from OriGene Technologies | Biocompare.com

Supplier Images

ENC1 Rabbit Polyclonal Antibody

WB Suggested Anti-ENC1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: ACHN cell lysate

Be the first to write a review!

Supplier Page from
OriGene Technologies for
ENC1 Rabbit Polyclonal Antibody

OriGene Technologies' ENC1 Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot.

Description

Rabbit Polyclonal Anti-ENC1 Antibody

Product Specs
ItemENC1 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA335766
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetENC1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL
NCBI Full Gene Nameectodermal-neural cortex 1
NCBI Gene AliasesKLHL37, KLHL35, TP53I10, PIG10, NRPB, CCL28, ENC-1
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!