Retinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody TA329803 from OriGene Technologies | Biocompare.com

Supplier Images

Retinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody

Host: Rabbit; Target Name: RBBP6; Sample Tissue: ACHN Whole cell lysates; Antibody Dilution: 1.0ug/ml

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Retinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody

The Retinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RBBP6. This antibody recognizes Homo Sapiens, and Human antigen. The Retinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RBBP6 Antibody

Product Specs
ItemRetinoblastoma binding protein 6 (RBBP6) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA329803
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetRetinoblastoma binding protein 6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RBBP6 antibody is: synthetic peptide directed towards the N-terminal region of Human RBBP6. Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA
NCBI Full Gene NameRB binding protein 6, ubiquitin ligase
NCBI Gene AliasesPACT, MY038, P2P-R, RBQ-1, SNAMA
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!