RAD54 (RAD54L) Rabbit Polyclonal Antibody TA341561 from OriGene Technologies | Biocompare.com

Supplier Images

RAD54 (RAD54L) Rabbit Polyclonal Antibody

WB Suggested Anti-RAD54L Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Placenta

Be the first to write a review!

Supplier Page from
OriGene Technologies for
RAD54 (RAD54L) Rabbit Polyclonal Antibody

The RAD54 (RAD54L) Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to RAD54 like, and RAD54L. This antibody recognizes Homo Sapiens, and Human antigen. The RAD54 (RAD54L) Rabbit Polyclonal Antibody has been shown to work in the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-RAD54L Antibody

Product Specs
ItemRAD54 (RAD54L) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA341561
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
ReactivityHuman
TargetRAD54
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-RAD54L antibody: synthetic peptide directed towards the N terminal of human RAD54L. Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR
NCBI Full Gene NameRAD54 like
NCBI Gene AliaseshHR54, HR54, hRAD54, RAD54A
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!