Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody TA332101 from OriGene Technologies | Biocompare.com

Supplier Images

Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody

WB Suggested Anti-RNASET2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateRNASET2 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody

Rabbit Anti-RNASET2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in in alveolar cells, type I and II; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody:

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody

OriGene Technologies' Ribonuclease T2 (RNASET2) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-RNASET2 Antibody

Product Specs
ItemRibonuclease T2 (RNASET2) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price $585.00Supplier Page View Company Product Page
Catalog NumberTA332101
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
ReactivityHuman
TargetRibonuclease T2
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-RNASET2 Antibody: synthetic peptide directed towards the middle region of human RNASET2. Synthetic peptide located within the following region: RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI
NCBI Full Gene Nameribonuclease T2
NCBI Gene AliasesbA514O12.3, RNASE6PL
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!