2-APB, Ca2+ release modulator ab120124 from Abcam

Product Specs
Item2-APB, Ca2+ release modulator
CompanyAbcam
Price Supplier Page View Company Product Page
Catalog Numberab120124
Quantity100 mg
Purity0.99
TypeChemical
Molecule Name2-Aminoethyl diphenylborinate

Add to Compare List

Abcam

Discovery Drive

Cambridge Biomedical Campus

Cambridge CB2 0AX

United Kingdom

Phone: +44 (0) 1223 696000 (option 1)
+44 (0) 1223 696000 (option 2)
+44 (0) 1223 771600

Company Profile

Website: http://www.abcam.com

(1) Calcium waves and nuclear tension changes coordinate mechanical stress dissipation in locally folded epitheliaiScienceJanuary 16, 2026Marvin Brun-Cosme-Bruny, Lydia Pernet, Kenny Elias, Christophe Guilluy, Christiane Oddou, Monika Elzbieta Dolegapeptides, and recombinant proteins" ,, Fluo-4 Direct Calcium Assay Kit,Invitrogen,#F10471 2-APB,Abcam,#ab120124 Ruthenium,MERCK,#557450-250MG 18α-Glycyrrhetinic acid,MERCK,#G8503 Apyrase (ATP-diphospohydrolase),MERCK,#A6410 Cycloheximide,MERCK,#C4859-1ML Y27632,MedChemExpress,#hy10583 Thapsigargin,MERCK,#SML1845 Bapta-AM,MERCK,#A1076-25MG Calcium

(2) Calcium transients regulate the apical emergence of basally located progenitors during Xenopus skin developmentNature communicationsJuly 19, 2025Christodoulou N, Skourides PA.until sibling embryos reached stage 24. Inhibitor Treatment Embryos were treated with 2APB (Abcam, ab120124) 25 uM and 12,5 uM), U73122 (Santa Cruz Biotechnology, sc-3574) 2.5 uM and W7 (Tocris, 0369) 50uM. Before

(3) Dissecting the Mechanical Control of Mitotic Entry Using a Cell Confinement SetupBIO-PROTOCOLJanuary 1, 2025Margarida Dantas, Débora Vareiro, Jorge G. FerreiraminBAPTA-AM (Abcam, catalog number: ab120503), used at 10 μM for 15 min2APB (Abcam, catalog number: ab120124), used at 10 μM for 30 minPara-nitro-blebbistatin (MotorPharma, catalog number: 1621326-32-6), used

(4) Functional imaging-guided cell selection for evolving genetically encoded fluorescent indicatorsCell Reports MethodsAugust 1, 2023Chang Lin, Lihao Liu, Peng ZouMedium,Gibco,31985062 Ionomycin,Cayman,11932 Protease K,Thermo,EO0491 HEPES,Amresco,0511 EGTA,Sigma,03777-10G 2-APB,Abcam,ab120124 Gabazine,Abcam,ab120042 NBQX,Abcam,ab120045 D-AP5 (APV),Abcam,ab120003 ,, Critical commercial assays,Critical

(5) Mitochondria-associated membrane protein PACS2 maintains right cardiac function in hypobaric hypoxiaiScienceApril 21, 2023Jie Yang, Mengjia Sun, Renzheng Chen, Xiaowei Ye, Boji Wu, Zhen Liu, Jihang Zhang, Xubin Gao, Ran Cheng, Chunyan He, et al.(acetoxymethyl ester) (BAPTA-AM; B1205, Molecular probes) in HBSS. Further, 2-aminoethoxydiphenyl borate (2-APB; ab120124, Abcam), TG (T9033, Sigma-Aldrich), and adenosine triphosphate (ATP; A1852, Sigma-Aldrich) were added

(6) Nuclear tension controls mitotic entry by regulating cyclin B1 nuclear translocationThe Journal of cell biologyDecember 5, 2022Dantas M, Oliveira A, Aguiar P, Maiato H, Ferreira JG.To block the release of calcium ions from internal cellular stores, BAPTA-AM and 2APB (ab120503 and ab120124, respectively; Abcam) were used at 10 μM for 15–30 min. Myosin activity was perturbed using p-nitro-blebbistatin

(7) Detection of TRPM6 and TRPM7 Proteins in Normal and Diseased Cardiac Atrial Tissue and Isolated CardiomyocytesInternational journal of molecular sciencesNovember 28, 2022Andriulė I, Pangonytė D, Gwanyanya A, Karčiauskas D, Mubagwa K, Mačianskienė R.optical density of the samples to the standard curve. 4.4. Chemicals 2-APB was obtained from Abcam (ab120124, Cambridge, UK) and carvacrol (CAR, ≥97% purity) was purchased from Carl Roth GmbH + Co (Karlsruhe,

(8) PINK1-Dependent Mitophagy Reduced Endothelial Hyperpermeability and Cell Migration Capacity Under Simulated MicrogravityFrontiers in cell and developmental biologyJanuary 1, 2022Li C, Pan Y, Tan Y, Wang Y, Sun X.InvivoGen, San Diego, CA, United State), MitoTEMPO (ab144644, Abcam, Cambridge, United Kingdom), and 2-APB (ab120124, Abcam). Mitochondrial Isolation Cell mitochondrial extraction kits (C3601, Beyotime, Shanghai, China)

(9) A synaptic temperature sensor for body coolingNeuronOctober 20, 2021Kamm GB, Boffi JC, Zuza K, Nencini S, Campos J, Schrenk-Siemens K, Sonntag I, Kabaoğlu B, El Hay MYA, Schwarz Y, et al.oil,Sigma,55007 Castor oil,Sigma,239853 CNQ,Enzo,BML-NS105-0025 ADP Ribose,Sigma-Aldrich,A0752 2-APB,Abcam,ab120124 SR 95531 hydrobromide (Gabazine),Hello Bio,HB0901 D-AP5,Hello Bio,HB0225 Tetrodotoxin citrate,Hello Bio

(10) Evidence for the expression of TRPM6 and TRPM7 in cardiomyocytes from all four chamber walls of the human heartScientific reportsJuly 29, 2021Andriulė I, Pangonytė D, Almanaitytė M, Patamsytė V, Kuprytė M, Karčiauskas D, Mubagwa K, Mačianskienė R.(CAR, ≥ 97% purity) was purchased from Carl Roth GmbH + Co (Karlsruhe, Germany), 2-APB from Abcam (ab120124, Cambridge, UK), and other chemicals were from Sigma-Aldrich (St. Louis, MO, USA). Water-insoluble compounds

(11) Local Resting Ca2+ Controls the Scale of Astroglial Ca2+ SignalsCell ReportsMarch 10, 2020Claire M. King et al.#1069 DHPG,Tocris,Cat. #0342/1 Phenylephrine,Sigma-Aldrich,Cat. P6126 Ryanodine,Abcam,Cat. AB120083 2-APB,Abcam,Cat. AB120124 Alexa Fluor 594 Hydrazide,ThermoFisher,A10438 Alexa Fluor 488 Hydrazide,ThermoFisher,A10436 Oregon

(12) Porcine deltacoronavirus (PDCoV) modulates calcium influx to favor viral replicationVirologyJanuary 1, 2020Dongcheng Bai, Liurong Fang, Sijin Xia, Wenting Ke, Jing Wang, Xiaoli Wu, Puxian Fang, Shaobo XiaoBepridil hydrochloride (cat: HY-103315) and BAPTA-AM (cat: HY-100545) were purchased from MedChemExpress. 2-APB (cat: ab120124) was purchased from Abcam. All drugs were dissolved in DMSO or H2O following the manufacturer's instructions.

(13) Fas signaling-mediated T(H)9 cell differentiation favors bowel inflammation and antitumor functionsNature communicationsJuly 2, 2019Shen Y, Song Z, Lu X, Ma Z, Lu C, Zhang B, Chen Y, Duan M, Apetoh L, Li X, et al.(S7697, 0.5 μM, Selleck), enzastaurin (S1055, 0.5 μM, Selleck), Go 6983 (S2911, 0.01 μM, Selleck), 2-APB (ab120124, 10 μM, Abcam, Cambridge, MA, USA), XC (ab120914, 10 μM, Abcam), U73122 (S8011, 0.1 μM, Selleck), manoalide

(14) Bcl-2 overexpression reduces cisplatin cytotoxicity by decreasing ER-mitochondrial Ca2+ signaling in SKOV3 cellsOncology reportsMarch 1, 2018Xu L, Xie Q, Qi L, Wang C, Xu N, Liu W, Yu Y, Li S, Xu Y.dilution), anti-IP3R (ab5804; rabbit Ab; 1:1,000 dilution) and 2-aminoethyl diphenylborinate (2-APB, ab120124) Abs were purchased from Abcam Ltd. (Hong Kong, China). Anti-β-actin (60008–1-Ig; murine Ab; 1:2,000

(15) TAT‑fused IP3R‑derived peptide enhances cisplatin sensitivity of ovarian cancer cells by increasing ER Ca2+ releaseInternational journal of molecular medicineFebruary 1, 2018Xie Q, Xu Y, Gao W, Zhang Y, Su J, Liu Y, Guo Y, Dou M, Hu K, Sun L.The sequence for TAT-IDPS is RKKRRQRRRGGNVYTEIKCNSLLPLDDIVRV. 2-Aminoethyl diphenylborinate (2-APB; ab120124) was purchased from Abcam (Hong Kong) Ltd. Cell lines Cisplatin-resistant ovarian cancer SKOV3/DDP

(16) ABT737 reverses cisplatin resistance by regulating ER-mitochondria Ca2+ signal transduction in human ovarian cancer cellsInternational journal of oncologyDecember 1, 2016Xie Q, Su J, Jiao B, Shen L, Ma L, Qu X, Yu C, Jiang X, Xu Y, Sun L.dimethyl sulfoxide (DMSO) for in vitro use and animal studies. 2-aminoethyl diphenylborinate (2-APB) (ab120124) was purchased from Abcam Ltd. Cell culture. The cisplatin-resistant clone SKOV3/DDP was obtained from

Be the First to Write a Review!

2-APB, Ca2+ release modulator from Abcam

Description

Abcam

Citations (16)

Reviews

2-APB, Ca2+ release modulator from Abcam

About Biocompare

Advertise with Us

Specialized Search Tools

Site Map