MSRB3 Rabbit Polyclonal Antibody (FITC) orb2095587 from Biorbyt

Product Specs
ItemMSRB3 Rabbit Polyclonal Antibody (FITC)
CompanyBiorbyt
Price Supplier Page
Catalog Numberorb2095587
ClonalityPolyclonal
FormatLiquid. Purified antibody supplied in 1x PBS buffer
ApplicationsIHC
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence ESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEA
TargetMSRB3 Rabbit Polyclonal
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding
Conjugate/TagFITC
HostRabbit
Quantity100 ul
NCBI Full Gene Namemethionine sulfoxide reductase B3
NCBI Gene AliasesDFNB74
Molecular Weight21 kDa