NT5M Antibody - BSA Free NBP1-92203 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

NT5M Antibody

Western Blot: NT5M Antibody [NBP1-92203]
NT5M Antibody

NT5M Antibody
NT5M Antibody

Western Blot: NT5M Antibody [NBP1-92203] - Analysis in control (vector only transfected HEK293T lysate) and NT5M over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
NT5M Antibody

Western Blot: NT5M Antibody [NBP1-92203] - Analysis in control (vector only transfected HEK293T lysate) and NT5M over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
NT5M Antibody - BSA Free

Product Specs
ItemNT5M Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-92203
ApplicationsWB, IHC, IHC-p
ReactivityHuman (Hu)
PurityAffinity purified
Research AreaLipid and Metabolism
NCBI Full Gene Name5',3'-nucleotidase, mitochondrial
NCBI Gene AliasesdNT-2, dNT2, mdN
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Antibody TypePrimary Antibodies
ClonalityPolyclonal
IsotypeIgG
HostRabbit
FormatPBS (pH 7.2) and 40% Glycerol
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
TargetNT5M
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: FELEPLPGAV EAVKEMASLQ NTDVFICTSP IKMFKYCPYE KYAWVEKYFG PDFLEQIVLT RDKT

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Sequence

FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!