Fucosyltransferase 2/FUT2 Antibody

Product Specs
ItemFucosyltransferase 2/FUT2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-80775
HostRabbit
TargetFucosyltransferase 2/FUT2
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: QRLAKIQAMW ELPVQIPVLA STSKALGPSQ LRGMWTINAI GRLGNQMGEY ATLYALAKMN GRPAFIPAQM HSTL
FormatPBS (pH 7.2) and 40% Glycerol
NCBI Gene AliasesB12QTL1, SEC2, Se2, SE, sej
ApplicationsImmunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
ReactivityHuman
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
NCBI Full Gene Namefucosyltransferase 2
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Molecular Weight39 kDa
Antibody TypePrimary Antibodies
Research AreaAmino Acids Drugs and other small molecules, Endocrinology, Immunology, Signal Transduction
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTL

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

(1) FUT2 Variants Confer Susceptibility to Familial Otitis MediaAmerican journal of human geneticsJanuary 1, 0001"Santos-Cortez RLP, Chiong CM, Frank DN, Ryan AF, Giese APJ, Bootpetch Roberts T, Daly KA, Steritz MJ, Szeremeta W, Pedro M, et al."

(2) ABCA1 and cholesterol transfer protein Aster-A promote an asymmetric cholesterol distribution in the plasma membraneThe Journal of biological chemistryJanuary 1, 0001"Ogasawara F, Ueda K."

(3) The E3 ligase subunit FBXO45 binds the interferon-λ receptor and promotes its degradation during influenza virus infectionThe Journal of biological chemistryJanuary 1, 0001"Tsai M, Osman W, Adair J, ElMergawy R, Chafin L, Johns F, Farkas D, Elhance A, Londino J, Mallampalli RK."

Be the First to Write a Review!