HECTD2 Antibody - BSA Free NBP1-83481 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

HECTD2 Antibody

Western Blot: HECTD2 Antibody [NBP1-83481]
HECTD2 Antibody

Western Blot: HECTD2 Antibody [NBP1-83481] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
HECTD2 Antibody

HECTD2 Antibody
HECTD2 Antibody

Western Blot: HECTD2 Antibody [NBP1-83481] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
HECTD2 Antibody

Western Blot: HECTD2 Antibody [NBP1-83481] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
HECTD2 Antibody - BSA Free

Product Specs
ItemHECTD2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-83481
ReactivityHuman
TargetHECTD2
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: SPAHLVFPNI KNVREPPPIC LDVRQKQRTS MDASSSEMKA PVLPEPILPI QPKTVKDFQE DVEKVKSSGD WKA
FormatPBS (pH 7.2) and 40% Glycerol
HostRabbit
Quantity0.1 ml (also 25ul)
Conjugate/TagUnconjugated
ApplicationsWB, IHC, IHC-p
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
NCBI Full Gene NameHECT domain E3 ubiquitin protein ligase 2
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

Sequence

SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!