C2CD2 Antibody - BSA Free NBP1-88278 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

C2CD2 Antibody

Immunocytochemistry/Immunofluorescence: C2CD2 Antibody [NBP1-88278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
C2CD2 Antibody

C2CD2 Antibody
C2CD2 Antibody

Immunocytochemistry/Immunofluorescence: C2CD2 Antibody [NBP1-88278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
C2CD2 Antibody

Immunocytochemistry/Immunofluorescence: C2CD2 Antibody [NBP1-88278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
C2CD2 Antibody

Immunocytochemistry/Immunofluorescence: C2CD2 Antibody [NBP1-88278] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
C2CD2 Antibody - BSA Free

Product Specs
ItemC2CD2 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $539.00Supplier Page View Company Product Page
Catalog NumberNBP1-88278
ReactivityHuman
Quantity0.1 ml (also 25ul)
HostRabbit
Conjugate/TagUnconjugated
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: AKSKELHLQI SEAGRSSEGL LATATVPLDL FKKQPSGPQS FTLTSGSACG SSVLGSVTAE FSYMEPGELK SWPIP
FormatPBS (pH 7.2) and 40% Glycerol
ApplicationsImmunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
TargetC2CD2
IsotypeIgG
ClonalityPolyclonal
PurityAffinity purified
Research AreaStem Cell Markers
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Gene AliasesC21orf25, C21orf258, TMEM24L
NCBI Full Gene NameC2 calcium dependent domain containing 2

Sequence

AKSKELHLQISEAGRSSEGLLATATVPLDLFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIP

Specifications/Features

Available conjugates: Available conjugates: Unconjugated

Sizes Available: 0.1 ml (also 25ul)

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!