LCoR Antibody NBP1-83477 from Novus Biologicals, a Bio-Techne Brand

Product Specs
ItemLCoR Antibody
CompanyNovus Biologicals, a Bio-Techne Brand
Price $499.00Supplier Page View Company Product Page
Catalog NumberNBP1-83477
Quantity0.1 ml (also 25ul)
ApplicationsIF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
Conjugate/TagUnconjugated
FormatPBS (pH 7.2) and 40% Glycerol
PurityAffinity purified
ReactivityHuman
TargetLCoR
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: HGQHLILSRE ASWAKPHYEF NLSRMKFRGN GALSNISDLP FLAENSAFPK MALQAKQDGK KDVSHSSPVD LKIPQVRGMD LSWE
NCBI Full Gene Nameligand dependent nuclear receptor corepressor
NCBI Gene AliasesC10orf12, MLR2
ClonalityPolyclonal
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles

HGQHLILSREASWAKPHYEFNLSRMKFRGNGALSNISDLPFLAENSAFPKMALQAKQDGKKDVSHSSPVDLKIPQVRGMDLSWE

Available conjugates: Sizes Available: 0.1 ml (also 25ul)

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

(1) Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient SurvivalTranslational oncologyJanuary 1, 0001"Sixou S, Müller K, Jalaguier S, Kuhn C, Harbeck N, Mayr D, Engel J, Jeschke U, Ditsch N, Cavaillès V."rabbit polyclonal anti-NRIP1 HPA046571 (1:400 in PBS; Sigma-Aldrich) and the mouse polyclonal anti-LCoR NBP1–83477 antibody (1:50 in PBS; Novus Biologicals, Littleton, CO, USA) at 4 °C for 16 hours. After incubation

(2) Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient SurvivalTranslational oncologyJanuary 1, 0001"Sixou S, Müller K, Jalaguier S, Kuhn C, Harbeck N, Mayr D, Engel J, Jeschke U, Ditsch N, Cavaillès V."rabbit polyclonal anti-NRIP1 HPA046571 (1:400 in PBS; Sigma-Aldrich) and the mouse polyclonal anti-LCoR NBP1–83477 antibody (1:50 in PBS; Novus Biologicals, Littleton, CO, USA) at 4 °C for 16 hours. After incubation

LCoR Antibody