RANBP6 Antibody - BSA Free NBP1-86199 from Novus Biologicals, a Bio-Techne Brand | Biocompare.com

Supplier Images

RANBP6 Antibody

Immunocytochemistry/Immunofluorescence: RANBP6 Antibody [NBP1-86199] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
RANBP6 Antibody

RANBP6 Antibody
RANBP6 Antibody

Immunocytochemistry/Immunofluorescence: RANBP6 Antibody [NBP1-86199] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
RANBP6 Antibody

Immunocytochemistry/Immunofluorescence: RANBP6 Antibody [NBP1-86199] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
RANBP6 Antibody

Immunocytochemistry/Immunofluorescence: RANBP6 Antibody [NBP1-86199] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Be the first to write a review!

Supplier Page from
Novus Biologicals, a Bio-Techne Brand for
RANBP6 Antibody - BSA Free

Product Specs
ItemRANBP6 Antibody - BSA Free
CompanyNovus Biologicals, a Bio-Techne Brand
Price $589.00Supplier Page View Company Product Page
Catalog NumberNBP1-86199
FormatPBS (pH 7.2) and 40% Glycerol
TargetRANBP6
ApplicationsICC, IF, IHC, IHC-p
ReactivityHuman (Hu)
ClonalityPolyclonal
PurityAffinity purified
Antibody TypePrimary Antibodies
StorageStore at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
NCBI Full Gene NameRAN binding protein 6
IsotypeIgG
Conjugate/TagUnconjugated
Quantity0.1 ml (also 25ul)
ImmunogenThis antibody was developed against Recombinant Protein corresponding to amino acids: ATASAGVPAT VSEKQEFYQL LKNLINPSCM VRRQAEEIYE
HostRabbit

Specifications/Features

Available conjugates: Unconjugated

Sequence

ATASAGVPATVSEKQEFYQLLKNLINPSCMVRRQAEEIYE

Add to Compare List

Novus Biologicals, a Bio-Techne Brand

United States: 10771 E Easter Ave

Centennial, Colorado 80112

United States

Phone:
303-730-1950
888-506-6887

Email: novus@novusbio.com

Company Profile

Website: https://www.novusbio.com

Be the First to Write a Review!